General Information

  • ID:  hor000144
  • Uniprot ID:  Q9GT02(27-64)
  • Protein name:  CHH precursor-related peptide
  • Gene name:  NA
  • Organism:  Carcinus maenas (Common shore crab) (Green crab)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  sinus gland
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carcinus (genus), Carcinidae (family), Portunoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSTPGYGRMDRILAALKTSPMEPSAALAVEHGTTHPLE
  • Length:  38(27-64)
  • Propeptide:  MYSKTIPAMLAIITVAYLCPLPHAHARSTPGYGRMDRILAALKTSPMEPSAALAVEHGTTHPLEKKQIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRNNCFENEVFDVCVYELYFP
  • Signal peptide:  MYSKTIPAMLAIITVAYLCPLPHAHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9GT02-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000144_AF2.pdbhor000144_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 472277 Formula: C175H286N52O55S2
Absent amino acids: CFNQW Common amino acids: A
pI: 7.71 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 11
Hydrophobicity: -40 Boman Index: -6419
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 72.11
Instability Index: 2969.21 Extinction Coefficient cystines: 1490
Absorbance 280nm: 40.27

Literature

  • PubMed ID:  19523386
  • Title:  Characterization of the Carcinus Maenas Neuropeptidome by Mass Spectrometry and Functional Genomics